PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13896.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 307aa    MW: 33017.8 Da    PI: 9.9308
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13896.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.85e-381372261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                ++++lkcprC+stntkfCyynnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk++
  KHN13896.1 13 PDASLKCPRCESTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRN 72
                67899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-27162IPR003851Zinc finger, Dof-type
PfamPF027011.5E-321571IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3851771IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101955IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MADRARMAKI HQPDASLKCP RCESTNTKFC YYNNYSLSQP RHFCKTCRRY WTRGGALRSV  60
PVGGGCRRNK RNKGNSARSK SPMKPSTGST SASANSSSSG CTPDHVMMTH LPTPTPAHQF  120
PFLASLHHYN SDYASGGIGS HLGAITTPLV ARNGNTTSDV EFQIGTSSAS SLGNSGGGAM  180
LSNNGLGEQL RFNNLQQVQH QFPFFSTNLE PQLGVFQFGG GENNNVEPPN YAKNGGRFDI  240
RSKMDSISSV SGTLPQLNTI KLEENQGLSL PKNLLMTSSG NGVLWNGSSG NAWSEVPSFT  300
PSPNHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006603038.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLA0A0B2PX360.0A0A0B2PX36_GLYSO; Dof zinc finger protein DOF2.4
STRINGGLYMA18G52661.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.19e-34DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]